DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and RGD1566337

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:165 Identity:48/165 - (29%)
Similarity:67/165 - (40%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NGLTELKDRGQYLLH--SEKW-----ADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMF-YGNL 63
            |.:..::|:.|.|..  .|.|     .||..:|....    ...||.:||..||||..|| :..|
  Rat   162 NTIPAIRDQRQVLSDDLGELWENFIFTDCSLVVAGQE----FRAHKAILAARSPVFRAMFEHEML 222

  Fly    64 PDKTDPIVIPDVQPEAFEAMLEYIYTDRIT-IGSFDKACELCYVAKKYMLPHVVTRCTHFLWADL 127
            ...|:.|.|.|:....|:.|:.:|||.:.. :.|...|..|...|..|.|..:...|...|..:|
  Rat   223 ESLTNRIEIHDIHLHVFKEMMGFIYTGKAPHLHSHSMATRLLAAADMYDLQDLKVMCEDALCRNL 287

  Fly   128 SPKNACRAYEFAKLFDEPRLMQSSMDLIAANTREV 162
            |.:||......|.......|...:||.|..:..||
  Rat   288 SVENAVSTLILADFHSTEHLKTKAMDFIILHASEV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 33/112 (29%)
BTB 27..127 CDD:197585 31/101 (31%)
BACK 136..>199 CDD:197943 7/27 (26%)
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761
BTB_POZ 165..292 CDD:365784 38/130 (29%)
BACK 287..353 CDD:421692 11/36 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.