DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Btbd17

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001128006.1 Gene:Btbd17 / 303660 RGDID:1563331 Length:507 Species:Rattus norvegicus


Alignment Length:387 Identity:80/387 - (20%)
Similarity:143/387 - (36%) Gaps:90/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKDRGQYLLHSEKWADCRFLVGSSPTQ--RLIAGHKLLLAMASPVFERMFYGNLPDKTDPIV-IP 73
            |..|.|.||.....:|....|.:..|.  |....|:|||.:.|.:|..:    |.::::.:: .|
  Rat    78 LLQRLQDLLRHGNASDVVLRVQAVGTDEVRAFHTHRLLLGLHSELFREL----LSNQSEVVLQEP 138

  Fly    74 DVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLS----PKNACR 134
            ......|:..:.|:|...:|: ...:|..|..:|.||.:..:......::.|.|:    |  |..
  Rat   139 GDCAAVFDKFIRYLYCGELTV-LLAQAIPLHRLATKYRVASLQRGVADYMRAHLAGGAGP--AVG 200

  Fly   135 AYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLK 199
            .|.:|....:..|.:|.:..:|.|...|.....:..:....|..:|.::.|.:..||:||:.|..
  Rat   201 WYHYAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHALEA 265

  Fly   200 F---------ASERGI-------LNESGQEETASGGQVLTKESPDNAAGHVLVEEIK-------- 240
            :         .:||.:       :..:...:..:....|.:..|  |...:|::..:        
  Rat   266 WLGRTRPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGP--AVADLLLQAYQFHAASPLH 328

  Fly   241 -----------------MEPDVAA--MVQHMHQDDEADSFET-------DAGMASTSSA------ 273
                             :.|...|  ::.:..:||.:.||:|       |||...|.:.      
  Rat   329 YAKFFHVNSSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSPRW 393

  Fly   274 ---------AAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIMDAQRTILDGA 326
                     |.||..|..||.|    ..|...||:..:.:..|||.     :..|:|:|.||
  Rat   394 LPVSLRPVYADAAGTALPAARP----EDGRPRLVVTPASSGGDAAG-----VSFQKTVLVGA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 23/106 (22%)
BTB 27..127 CDD:197585 22/102 (22%)
BACK 136..>199 CDD:197943 15/62 (24%)
Btbd17NP_001128006.1 BTB 92..187 CDD:279045 21/99 (21%)
BTB 93..191 CDD:197585 22/102 (22%)
BACK 198..296 CDD:197943 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.