Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001381934.1 | Gene: | BTBD3 / 22903 | HGNCID: | 15854 | Length: | 522 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 81/199 - (40%) |
---|---|---|---|
Similarity: | 111/199 - (55%) | Gaps: | 4/199 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DWQNGLTELKDRGQYLLHSEKWADCRFLVG-SSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
Fly 68 DPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNA 132
Fly 133 CRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCL 197
Fly 198 LKFA 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 48/104 (46%) |
BTB | 27..127 | CDD:197585 | 49/100 (49%) | ||
BACK | 136..>199 | CDD:197943 | 20/62 (32%) | ||
BTBD3 | NP_001381934.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 25..44 | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143705 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |