DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Btbd3

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_663509.2 Gene:Btbd3 / 228662 MGIID:2385155 Length:530 Species:Mus musculus


Alignment Length:199 Identity:81/199 - (40%)
Similarity:111/199 - (55%) Gaps:4/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DWQNGLTELKDRGQYLLHSEKWADCRFLVG-SSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
            :||.....:::|...:.:::..||..|:|| ...|||| .|||.:||:.|.||..||||.|.:..
Mouse   106 NWQGLYPTIRERNAVMFNNDLMADVHFVVGPPGGTQRL-PGHKYVLAVGSSVFHAMFYGELAEDK 169

  Fly    68 DPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNA 132
            |.|.||||:|.||.|||:|||.|.|.:.: |......|.||||::||:...|.:||...||.|||
Mouse   170 DEIRIPDVEPAAFLAMLKYIYCDEIDLAA-DTVLATLYAAKKYIVPHLARACVNFLETSLSAKNA 233

  Fly   133 CRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCL 197
            |.....:.||:||.|.|...::|.|.....|....|.||:..||.:||.:..||. .|:.:|...
Mouse   234 CVLLSQSCLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNA-KEIVVFEAA 297

  Fly   198 LKFA 201
            |.:|
Mouse   298 LNWA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 48/104 (46%)
BTB 27..127 CDD:197585 49/100 (49%)
BACK 136..>199 CDD:197943 20/62 (32%)
Btbd3NP_663509.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..48
BTB 121..224 CDD:279045 48/104 (46%)
BTB 129..228 CDD:197585 49/100 (49%)
BACK 234..340 CDD:197943 23/69 (33%)
PHR 385..528 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833893
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.