DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Klhl11

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_766153.1 Gene:Klhl11 / 217194 MGIID:2388648 Length:709 Species:Mus musculus


Alignment Length:216 Identity:54/216 - (25%)
Similarity:89/216 - (41%) Gaps:13/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RLIAGHKLLLAMASPVFERMFYGNLPDKTDPIV-------IPDVQPEAFEAMLEYIYTDRITI-- 94
            |....|:.:||.|:..|..:..|...:.....|       .|..:|:..||::||:||.||.:  
Mouse   107 REFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVST 171

  Fly    95 GSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRLMQSSMDLIAANT 159
            ||..:..||   |.:::|..:...|..||...|...|....:..|.::...:|...:.|:|..|.
Mouse   172 GSVHEVLEL---ADRFLLIRLKEFCGEFLKKKL
HLSNCVAIHSLAHMYTLSQLALKAADMIRRNF 233

  Fly   160 REVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTK 224
            .:|:.|..|..:....:...|....:.:|||..||..:||:........|...||.....: |::
Mouse   234 YKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLR-LSQ 297

  Fly   225 ESPDNAAGHVLVEEIKMEPDV 245
            ..|.....||..|.:....:|
Mouse   298 MKPTYLTRHVKPERLVANNEV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 25/92 (27%)
BTB 27..127 CDD:197585 27/96 (28%)
BACK 136..>199 CDD:197943 14/62 (23%)
Klhl11NP_766153.1 BTB 86..198 CDD:279045 26/93 (28%)
BTB 96..201 CDD:197585 27/96 (28%)
BACK 206..308 CDD:285009 22/102 (22%)
Kelch 1 361..408
KELCH repeat 400..440 CDD:276965
Kelch 2 409..454
Kelch_1 443..487 CDD:279660
KELCH repeat 444..489 CDD:276965
Kelch 3 456..502
KELCH repeat 492..542 CDD:276965
Kelch 4 504..557
KELCH repeat 568..650 CDD:276965
Kelch 5 611..662
Kelch 612..658 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.