DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Tdpoz1

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_683751.2 Gene:Tdpoz1 / 207213 MGIID:2449436 Length:365 Species:Mus musculus


Alignment Length:182 Identity:54/182 - (29%)
Similarity:77/182 - (42%) Gaps:31/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPD--KT 67
            |:|.|               :.||..||....    ...||.:||..||||..||...:.:  ||
Mouse   182 WENSL---------------FTDCCLLVAGHE----FRAHKAILAARSPVFRAMFEHEMKESLKT 227

  Fly    68 DPIVIPDVQPEAFEAMLEYIYTDRIT-IGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKN 131
             ||.|.::.|:.|:.|:.:|||.:.. :.|...||::...|.||.|..:...|...|..:||.||
Mouse   228 -PIKIHNLNPQVFKEMMGFIYTGKAPHLHSHSMACDVLPAADKYGLVSLKVLCEDALCRNLSVKN 291

  Fly   132 ACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQN 183
            |......|.|....:|...::|.||....||        .|.|...:||:.:
Mouse   292 ATHTLILADLHSTEKLKTQALDFIAYYASEV--------CETSEWKSILESH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 33/106 (31%)
BTB 27..127 CDD:197585 34/102 (33%)
BACK 136..>199 CDD:197943 12/48 (25%)
Tdpoz1NP_683751.2 MATH 16..154 CDD:295307
BTB 178..284 CDD:279045 36/121 (30%)
BTB 189..287 CDD:197585 34/102 (33%)
SPOP_C 287..349 CDD:269807 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.