DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and bath-42

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_498784.1 Gene:bath-42 / 176152 WormBaseID:WBGene00016803 Length:410 Species:Caenorhabditis elegans


Alignment Length:188 Identity:43/188 - (22%)
Similarity:86/188 - (45%) Gaps:26/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD----PIVIPDVQPEAFEAM 83
            |.:.||...||:    :.|..|:.:|...||||:.||  :.|:..:    .|.|.|.:.::..||
 Worm   216 ELFTDCVIHVGN----KHIKAHRCILGQNSPVFKSMF--SSPNMIEAQKGEIHIEDAKYDSVRAM 274

  Fly    84 LEYIYTDRI----TIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDE 144
            :|::||...    :.|:.|   |:..:|.||.:..:..:|...:...::.||..:...|:..:..
 Worm   275 VEFMYTGATESLESQGNID---EILAIADKYEVLMLKDQCERLIAQTINLKNVTQIAMFSDTYTA 336

  Fly   145 PRLMQSSMDLIAANTREVLSDPSFLDIEVS-------TLMAIL--DQNRLNIDSELDL 193
            ..|..:.:..:..:.|.|:....::.::.|       .|.|:|  ||:..::.|.:.:
 Worm   337 DYLKSAVIRFLTTHHRVVIKTQDWISLKKSRHELANELLEAVLSTDQDDDDVTSNIPI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 30/107 (28%)
BTB 27..127 CDD:197585 29/107 (27%)
BACK 136..>199 CDD:197943 11/67 (16%)
bath-42NP_498784.1 MATH 47..174 CDD:238068
BTB 212..315 CDD:279045 30/107 (28%)
BTB 220..319 CDD:197585 29/107 (27%)
SPOP_C 319..380 CDD:269807 9/60 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.