DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and W07A12.4

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001343736.1 Gene:W07A12.4 / 174454 WormBaseID:WBGene00012322 Length:528 Species:Caenorhabditis elegans


Alignment Length:246 Identity:57/246 - (23%)
Similarity:105/246 - (42%) Gaps:58/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIDWQNGLTE-----------------LKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLL 48
            :||||.:.|::                 |.|..:: .::.:::|....||    :.....|:|:|
 Worm    84 VDIDWVSPLSKEYSKPFSSDWFGDDRETLCDMAKF-YNNAQFSDVNMKVG----EESYPAHRLIL 143

  Fly    49 AMASPVFERM----FYGNLPDKTD-PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAK 108
            :.:|.||:||    :.|   ||.| .:|..::..:||...|.::|::.:.:.. |....|..:|.
 Worm   144 SKSSDVFDRMMSQKWNG---DKFDLELVEDELCQKAFAPFLRFMYSNHVVLHK-DNCLPLLVLAD 204

  Fly   109 KYMLPHVVTRCTHFLWADLSP------------KNACRAYEFAKLFDEPRLMQSSMDLIAANTRE 161
            ||.:..:...|..|..:::.|            ..|.:||       .|.|::|.|..||.....
 Worm   205 KYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAY-------HPSLIKSCMQAIALEFET 262

  Fly   162 VLS---DPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLKFA-----SER 204
            :|:   :..:.::....::.||..|.|.:.||..|:..|.|:.     |||
 Worm   263 LLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWIQAPNHSER 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 26/108 (24%)
BTB 27..127 CDD:197585 27/104 (26%)
BACK 136..>199 CDD:197943 16/65 (25%)
W07A12.4NP_001343736.1 BTB_POZ_BTBD17 108..219 CDD:349601 28/119 (24%)
BACK 236..342 CDD:197943 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.