DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and bath-40

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_493543.1 Gene:bath-40 / 173321 WormBaseID:WBGene00013689 Length:402 Species:Caenorhabditis elegans


Alignment Length:147 Identity:33/147 - (22%)
Similarity:59/147 - (40%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSSPTQRLIAG-----------HKLLLAMASPVFERMF-YGNLPDKTDP-IVIPDVQPEAFEAML 84
            |......::||           |...|...|.||:.|. :..:.:..:. |.|.|..|.:..||:
 Worm   219 GDGTDMTIVAGPLDGEREQFRVHAYKLRAHSDVFQMMLSHTEMRENQEKRIEILDFSPTSVRAMV 283

  Fly    85 EYIYTDRITIGSFD--KACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRL 147
            |:||...|. ...|  :|.::..:|:||.:..:...|...|...|:..|.......|:.::...|
 Worm   284 EFIYAGVIK-SDIDVYQAVDVMQIAEKYQILALKMTCEQHLLDRLNVNNVLECITHAERYNTDVL 347

  Fly   148 MQSSMDLIAANTREVLS 164
            ..:.:|....|.:.|::
 Worm   348 YDACVDFAIHNRQHVMA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 25/104 (24%)
BTB 27..127 CDD:197585 26/108 (24%)
BACK 136..>199 CDD:197943 5/29 (17%)
bath-40NP_493543.1 MATH 44..178 CDD:238068
BTB 214..324 CDD:279045 25/105 (24%)
BTB 223..327 CDD:197585 25/104 (24%)
SPOP_C_like 327..388 CDD:269810 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.