DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and CG43120

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001246754.1 Gene:CG43120 / 12798252 FlyBaseID:FBgn0262580 Length:286 Species:Drosophila melanogaster


Alignment Length:343 Identity:58/343 - (16%)
Similarity:108/343 - (31%) Gaps:146/343 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HKLLLAMASPVFERMFYGNLPDKTDPIVIPDVQPEAFEAMLEYIYT---DRITIGSFDKACELCY 105
            ||::||.||..|||:|    .:.::..::....||.|:..|::||.   |:  .|:.:....:|.
  Fly    34 HKIILACASEFFERLF----QEDSEEFLLDGTTPEVFQIFLDFIYAPNDDQ--FGNLEPDVLMCL 92

  Fly   106 V--AKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSF 168
            :  |..::...:..||...| .||||                                       
  Fly    93 LKCANMWLAVEIEERCIDIL-LDLS
P--------------------------------------- 117

  Fly   169 LDIEVSTLMAILDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTKESPDNAAGH 233
             |::...|:|:.                                                 |..|
  Fly   118 -DMDPDALIALF-------------------------------------------------AVSH 132

  Fly   234 VLVEEIKMEPDVAAMVQHMHQDD---------EADS----FETDAGMASTSSAAAAAAAAPTAAS 285
            .:..::.||..: .::||:.:::         |.|.    |:..:||.|....            
  Fly   133 CVDHKVLMEQSI-GVLQHIWRNEMDCPSTVRMEVDCFGEYFKNTSGMLSPRRR------------ 184

  Fly   286 PPLDVASGSDDLVIIDSDASADAAANMINIMDAQRTILDGAMLRQAVKKIRFLTMTPQQFAEGPA 350
                       .|::::....:...|        |.......:.|.:|.|.||.|:.:.|..||.
  Fly   185 -----------FVMVENWIKGNDLNN--------RPCSQKDKINQIIKSINFLEMSLEDFYNGPG 230

  Fly   351 RSKLLQQHEALSILIKIS 368
            :|.:|...:...|:.|::
  Fly   231 KSNVLPDSDKFEIMYKLA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 22/83 (27%)
BTB 27..127 CDD:197585 23/87 (26%)
BACK 136..>199 CDD:197943 3/62 (5%)
CG43120NP_001246754.1 BTB 12..113 CDD:279045 23/85 (27%)
BTB 21..116 CDD:197585 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.