DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and BTBD11

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001018082.1 Gene:BTBD11 / 121551 HGNCID:23844 Length:1104 Species:Homo sapiens


Alignment Length:183 Identity:40/183 - (21%)
Similarity:74/183 - (40%) Gaps:20/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTELKDR-----GQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD 68
            |||:|.:     ..:.|::::.:|..|||...|    ...||:||..|||.|:.:......:...
Human   901 LTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRP----FYAHKVLLFTASPRFKALLSSKPTNDGT 961

  Fly    69 PIVIPDVQPEAFEAMLEYIY---TDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPK 130
            .|.|..|:...|:.:::|:|   .:.:.|.: ::..||...||.:.|..:...|.......::..
Human   962 CIEIGYVKYSIFQLVMQYLYYGGPESLLIKN-NEIMELLSAAKFFQLEALQRHCEIICAKSINTD 1025

  Fly   131 NACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQN 183
            |....|..||......|..........|...::.:.:|..:       :.|:|
Human  1026 NCVDIYNHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQL-------LYDKN 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 27/106 (25%)
BTB 27..127 CDD:197585 26/102 (25%)
BACK 136..>199 CDD:197943 8/48 (17%)
BTBD11NP_001018082.1 H2A 200..>244 CDD:305064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..301
Ank_4 <580..624 CDD:290365
ANK 598..751 CDD:238125
ANK 1 603..632
ANK repeat 606..647 CDD:293786
Ank_2 608..716 CDD:289560
ANK repeat 649..680 CDD:293786
ANK 2 649..678
ANK repeat 682..712 CDD:293786
ANK 3 687..716
Ank_2 692..>752 CDD:289560
ANK 4 730..759
ANK 5 825..854
BTB 915..1018 CDD:279045 27/107 (25%)
BTB 924..1022 CDD:197585 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.