DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and BTBD9

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001092742.1 Gene:BTBD9 / 114781 HGNCID:21228 Length:612 Species:Homo sapiens


Alignment Length:498 Identity:103/498 - (20%)
Similarity:183/498 - (36%) Gaps:149/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTDPIVIP--DVQPEAFE 81
            ||..|::.|..|:|    .::....|:::||.....|..:.||.:.:......||  |...|||.
Human    29 LLIGEEYGDVTFVV----EKKRFPAHRVILAARCQYFRALLYGGMRESQPEAEIPLQDTTAEAFT 89

  Fly    82 AMLEYIYTDRITIGSFDKACELCY--VAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDE 144
            .:|:||||.|.|:....:...|.:  :|.||..|.:....:.:|...|:.:|.|..::.|.|:..
Human    90 MLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILNIQNVCMTFDVASLYSL 154

  Fly   145 PRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDS----ELDLFNCLLKFASERG 205
            |:|.......:..|.:||||...||.:..:.|:.|:.:     ||    |.|:|..||.:.....
Human   155 PKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLR-----DSFAAPEKDIFLALLNWCKHNS 214

  Fly   206 --------------------ILNESGQEETASGGQVL-----TKESPD---NAAGHVLVEEIKME 242
                                :||........|...:|     ..||.|   |..|.::.||    
Human   215 KENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEE---- 275

  Fly   243 PDVAAM----------VQHMHQDDEADSFETDAGMASTSSAAAAAAAAPTAASPPLD-------- 289
             ::|.|          ::....|.:..:::.|.|.                :..|:|        
Human   276 -NIATMKYGAQVVKGELKSALLDGDTQNYDLDHGF----------------SRHPIDDDCRSGIE 323

  Fly   290 VASGSDDLV----IIDSDASADAAANMINI----MDAQRTILDGAMLRQAVKKIRFLTMTPQQFA 346
            :..|...::    |:..|..:.:.:..|.:    :|..|.|.....|.::.:|:.|         
Human   324 IKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYF--------- 379

  Fly   347 EGPAR----SKLLQQHEALSILIKI-----------------------SSPSLNDC-HMPEGFCV 383
              |||    .:::..|..::.:..|                       :..::.|| .:.||  |
Human   380 --PARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEG--V 440

  Fly   384 SRS--------TRNF-YESGHRHAQR-------ELSSSYRTGA 410
            |||        |:|: ::||:...|.       :|:..|..|:
Human   441 SRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 30/107 (28%)
BTB 27..127 CDD:197585 28/103 (27%)
BACK 136..>199 CDD:197943 19/66 (29%)
BTBD9NP_001092742.1 BTB_POZ_BTBD9 14..133 CDD:349596 30/107 (28%)
BACK_BTBD9 137..235 CDD:350518 23/102 (23%)
F5_F8_type_C 292..405 CDD:366285 20/139 (14%)
F5_F8_type_C 445..546 CDD:366285 8/39 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.