DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and LOC100911679

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_003749384.1 Gene:LOC100911679 / 100911679 RGDID:6491125 Length:358 Species:Rattus norvegicus


Alignment Length:166 Identity:50/166 - (30%)
Similarity:68/166 - (40%) Gaps:13/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QNGLTELKDRGQYLLH--SEKW-----ADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNL 63
            ||....:||..|.|..  .|.|     .||..:|....    ...||.:||..||||..||...:
  Rat   161 QNMTPAIKDPRQILADDVGELWENSLFTDCSLVVAGQE----FRAHKAILAGHSPVFRAMFEHEM 221

  Fly    64 PDK-TDPIVIPDVQPEAFEAMLEYIYTDRIT-IGSFDKACELCYVAKKYMLPHVVTRCTHFLWAD 126
            .:: |:.|...|:..:.|:.|:.:|||.:.. :.|...|..|...|..|.|..:...|...|..:
  Rat   222 QERLTNRIEFHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADMYDLQELKDMCEDSLCRN 286

  Fly   127 LSPKNACRAYEFAKLFDEPRLMQSSMDLIAANTREV 162
            ||.|||......|.|.....|...:||.|..:..||
  Rat   287 LSVKNAVPTLILADLHSTKHLKTRAMDFIILHASEV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 31/112 (28%)
BTB 27..127 CDD:197585 29/101 (29%)
BACK 136..>199 CDD:197943 8/27 (30%)
LOC100911679XP_003749384.1 MATH 16..153 CDD:295307
BTB 180..284 CDD:279045 30/107 (28%)
BTB 189..287 CDD:197585 29/101 (29%)
SPOP_C 287..348 CDD:269807 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.