Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001090697.1 | Gene: | btbd3 / 100036676 | XenbaseID: | XB-GENE-975947 | Length: | 518 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 75/197 - (38%) |
---|---|---|---|
Similarity: | 108/197 - (54%) | Gaps: | 2/197 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 WQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTDP 69
Fly 70 IVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACR 134
Fly 135 AYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLK 199
Fly 200 FA 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 44/103 (43%) |
BTB | 27..127 | CDD:197585 | 45/99 (45%) | ||
BACK | 136..>199 | CDD:197943 | 19/62 (31%) | ||
btbd3 | NP_001090697.1 | BTB_POZ_BTBD3 | 95..225 | CDD:349657 | 54/130 (42%) |
BACK_BTBD3 | 216..310 | CDD:350599 | 27/75 (36%) | ||
PHR | 373..516 | CDD:369646 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |