DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and btbd3

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001090697.1 Gene:btbd3 / 100036676 XenbaseID:XB-GENE-975947 Length:518 Species:Xenopus tropicalis


Alignment Length:197 Identity:75/197 - (38%)
Similarity:108/197 - (54%) Gaps:2/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTDP 69
            |:.....:::|...:.:::..||..|:||.....:.|.|||.:||:.|.||..||||.|.:..|.
 Frog    95 WRGLYATIRERNAVMFNNDLMADIHFVVGPPGGTQRIPGHKYVLAVGSSVFHAMFYGELAEDNDE 159

  Fly    70 IVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACR 134
            |.||||:|.||.|||:|:|.|.|.:.: |......|.||||::||:...|.:||...||.||||.
 Frog   160 IRIPDVEPAAFLAMLKYMYCDEIDLAA-DTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACV 223

  Fly   135 AYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLK 199
            ....:.||:||.|.|...::|.|.....|....|.||:..|..:||::..||. .|:.:|...|.
 Frog   224 LLSQSCLFEEPDLTQRCWEVIEAQAELALKSEGFCDIDFQTFESILNRETLNA-KEIVVFEAALN 287

  Fly   200 FA 201
            :|
 Frog   288 WA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 44/103 (43%)
BTB 27..127 CDD:197585 45/99 (45%)
BACK 136..>199 CDD:197943 19/62 (31%)
btbd3NP_001090697.1 BTB_POZ_BTBD3 95..225 CDD:349657 54/130 (42%)
BACK_BTBD3 216..310 CDD:350599 27/75 (36%)
PHR 373..516 CDD:369646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.