DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG42397

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:217 Identity:48/217 - (22%)
Similarity:74/217 - (34%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRFQVCSVLILAWIACGHALAV-GSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLL 64
            |:.||:..:|.|      .||.| ||....|...::            |.|:.:.|:|.....|:
  Fly     1 MKGFQIIGLLGL------FALLVSGSTSSGEDTNIK------------LTTDESTTVEDTTEVLV 47

  Fly    65 FDGKGAVHNHCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCD 129
                                      |.:..|.......|:..:.|| ..|.:|.:||...:.|.
  Fly    48 --------------------------TTLPPPVLCADEDLFLPAPDC-REYYQCLYGEGILKICP 85

  Fly   130 AGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVE 194
            .||.:|..::.|.|..|   ||..:     |..|........|...||  .|...||.:.|.||.
  Fly    86 DGLYWDRELNVCAWDSQ---HCADD-----KNETTTPSTLNCASGLPF--LPYIPDCTKFIQCVY 140

  Fly   195 GHPRLISCGEDKVFDEHTLTCE 216
            .....:||.....:::...:|:
  Fly   141 NIGFKLSCPSGLYWNQPLQSCD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 5/46 (11%)
CBM_14 103..147 CDD:279884 13/43 (30%)
ChtBD2 179..218 CDD:214696 9/38 (24%)
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 13/44 (30%)
ChtBD2 125..163 CDD:214696 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.