DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG13837

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:147 Identity:37/147 - (25%)
Similarity:59/147 - (40%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPT-- 163
            |.|:|..|....:.||.||.....|.:|..|..|||::..| ...:|:..|.....:..|.|:  
  Fly    32 QLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERC-LDRKLVSRCRDPVGITTKSPSMV 95

  Fly   164 -----KVDPNSVAARFWPFPRFPVAGDCHRLITCVEG--------HPRLISCGEDKVFDEHTLTC 215
                 |.:|.::..|.     .|.||.|:..:.|.||        ...|:||...:. .|:.:.|
  Fly    96 KKPAQKAEPLAITLRL-----LPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQT-RENIINC 154

  Fly   216 EDPEYA----SGSCANY 228
            ::..|.    ..:||.:
  Fly   155 QEGVYGFMPHPRNCAYF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884
CBM_14 103..147 CDD:279884 14/43 (33%)
ChtBD2 179..218 CDD:214696 12/46 (26%)
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 14/45 (31%)
CBM_14 154..203 CDD:279884 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.