DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and Gasp

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:234 Identity:81/234 - (34%)
Similarity:109/234 - (46%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRFQVCSVLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLF 65
            |::|.|..|.:.     |.|:|..|.:||:.:|.  |.|..:||:::.|.||...|:||.|||.|
  Fly     1 MKKFLVVFVALF-----GAAVAQSSFKCPDDFGF--YPHDTSCDKYWKCDNGVSELKTCGNGLAF 58

  Fly    66 DGKGAVH--NHCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDC 128
            |...:.:  .:|:|...|||..|.....||:||.|...:|::.....|. .:..|.:|||....|
  Fly    59 DATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFPDENKCD-VFWNCWNGEPSRYQC 122

  Fly   129 DAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCV 193
            ..|||||.....|.|.||:.|..|.|...||.||...:    .|....|.|.....||.:...|:
  Fly   123 SPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGE----LANAGSFSRHAHPEDCRKYYICL 183

  Fly   194 EGHPRLISCGEDKVF----DEHTLTCEDPEYASGSCANY 228
            ||..|...|....||    .:.|..|||||...| |.:|
  Fly   184 EGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVPG-CEDY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 18/48 (38%)
CBM_14 103..147 CDD:279884 15/43 (35%)
ChtBD2 179..218 CDD:214696 13/42 (31%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 19/52 (37%)
CBM_14 97..144 CDD:366726 16/47 (34%)
CBM_14 170..218 CDD:366726 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.