DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG17147

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:87/241 - (36%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLILAWIACGHALAVGSPE--CP-EKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFD-GKG 69
            ||:||.:|.  :.:||..|  |. .|.|.:. .....|||:..|.:|..|:.||.:...|: .||
  Fly    13 VLLLATVAL--SASVGEYEELCRLFKNGTKV-RKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKG 74

  Fly    70 AV-------HNHCNYNWAVDCKG--RQW--DPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEP 123
            :.       :.:|...    |:|  .:|  |||                  :|. .|..|.:|.|
  Fly    75 SCVDTLANSNKYCGNR----CEGLDGEWVADPT------------------ECH-KYFYCMNGVP 116

  Fly   124 HEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHR 188
            ....|..|..:|||...|.:.            |...|   ||.|::........:|....||..
  Fly   117 LAGMCPVGQHFDERSQSCLYG------------VDSMC---VDVNNICELVAENTKFRNEKDCAY 166

  Fly   189 LITCVE-GHPRLISCGEDKVFDEHTLTCEDPEY---ASGSCANYGK 230
            ...|.: |:....||         |:|.:..||   .||:|....|
  Fly   167 YYECDKTGNHASKSC---------TVTSKKREYFDVESGNCVEANK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 12/54 (22%)
CBM_14 103..147 CDD:279884 11/43 (26%)
ChtBD2 179..218 CDD:214696 9/39 (23%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/32 (34%)
ChtBD2 89..136 CDD:214696 17/69 (25%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.