DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG6996

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:178 Identity:37/178 - (20%)
Similarity:61/178 - (34%) Gaps:28/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAV 107
            |:.:..|.:|:....:|..||.:|.:.   ..|..:.::.|..        |.|......|..|.
  Fly    44 CNAWIQCIDGSPVSGSCATGLFYDRES---QKC
LSSSSIKCLS--------SDPCAALPTGFAAD 97

  Fly   108 SKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAA 172
            ...|: .|..|..|:.....|:.|:.::.....|              :..|.|..|:||:|. .
  Fly    98 PYSCN-GYYYCKDGKGTHGVCNTGMNFNSGTQDC--------------IRDFPCSNKMDPDSY-C 146

  Fly   173 RFWPFPRFPVAGD-CHRLITCVEGHPRLISCGEDKVFDEHTLTCEDPE 219
            ...|...|....| |:....|.:|.....:|.....|...|..|:.|:
  Fly   147 NILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 8/39 (21%)
CBM_14 103..147 CDD:279884 9/43 (21%)
ChtBD2 179..218 CDD:214696 9/39 (23%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 7/31 (23%)
ChtBD2 85..130 CDD:214696 9/45 (20%)
CBM_14 146..196 CDD:279884 11/49 (22%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.