DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG10140

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:85/225 - (37%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ACGHALAVGSPEC-P--EKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNY 77
            :|.|.   |..:| |  |.:....:::...|.::.||..|...|..|::||.::   :..:.|::
  Fly    98 SCVHP---GDADCLPTCEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQYN---SATDRCDF 156

  Fly    78 NWAVDCKGRQWDPTPISTPACEYQFGL---YAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIH 139
            ...|||         :.:....|....   |..||.....|..|.:|.|.||.|.|||.:..:..
  Fly   157 PQNVDC---------VESECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCD 212

  Fly   140 GCNWPD-------------QLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHR--L 189
            .|:.|.             |.|...:|...||. ||    |:.|  .|:       ..:..|  .
  Fly   213 CCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGI-CP----PSGV--HFY-------VHESRRDAY 263

  Fly   190 ITCVEGHPRLISCGEDKVFDEHTLTCEDPE 219
            ..||:||..::.|.....:|.....|.:|:
  Fly   264 YYCVDGHGLVLDCSAGLWYDPTVQECREPQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/46 (22%)
CBM_14 103..147 CDD:279884 15/59 (25%)
ChtBD2 179..218 CDD:214696 8/40 (20%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 3/10 (30%)
CBM_14 111..161 CDD:279884 10/52 (19%)
CBM_14 178..222 CDD:279884 15/43 (35%)
CBM_14 246..295 CDD:279884 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.