DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG10725

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:257 Identity:59/257 - (22%)
Similarity:93/257 - (36%) Gaps:79/257 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CSVLILAWIACGHALAVGSPECPEKY------------------------GVQAYAHTENCDQFF 47
            ||...|    |.:.:|| ..|||..|                        |:.::.:...|.::.
  Fly    42 CSKYFL----CMNEIAV-PRECPTDYYFDARDQECVPLMEVECIGSCKNRGLSSFCYDRTCTKYV 101

  Fly    48 LCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCK----GRQWDPTPISTPACEYQFGLYAVS 108
            ||.:||..:..|.:||.::   |:.:.|:|...|||.    .|..:|..|          ::..|
  Fly   102 LCFDGTPVIRQCSDGLQYN---ALTDRCDYPQYVDCVDNLCSRNNNPDDI----------VFIPS 153

  Fly   109 KDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAAR 173
            |.....|..|..|.|..|:|.:||.|:.....|::|.::  :|..|              |:...
  Fly   154 KARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKV--NCTVE--------------SLQRN 202

  Fly   174 FWPFPRFP--VAG-DC---------HR-----LITCVEGHPRLISCGEDKVFDEHTLTCEDP 218
            ..||.|.|  :|. :|         |:     ...|:.|....:.|....|||.....|.:|
  Fly   203 ILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCTPGLVFDAKREECREP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 12/46 (26%)
CBM_14 103..147 CDD:279884 13/43 (30%)
ChtBD2 179..218 CDD:214696 12/55 (22%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 10/35 (29%)
CBM_14 83..134 CDD:279884 13/53 (25%)
CBM_14 150..192 CDD:279884 13/41 (32%)
ChtBD2 216..264 CDD:214696 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.