Sequence 1: | NP_523418.1 | Gene: | Peritrophin-A / 33023 | FlyBaseID: | FBgn0022770 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261732.1 | Gene: | CG43896 / 39360 | FlyBaseID: | FBgn0264488 | Length: | 2113 | Species: | Drosophila melanogaster |
Alignment Length: | 227 | Identity: | 50/227 - (22%) |
---|---|---|---|
Similarity: | 78/227 - (34%) | Gaps: | 67/227 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 NCDQFFLCTNGTLTLETCENGLLFDGKGAV------HNHCNYNWAVDCKGRQWDPTPISTPACEY 100
Fly 101 QFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGC------------NWPDQLLEHCNP 153
Fly 154 EAVVGFKCPTKVDPNSVA-ARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCE- 216
Fly 217 ------------------DPEYASGSCANYGK 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Peritrophin-A | NP_523418.1 | CBM_14 | 36..83 | CDD:279884 | 14/46 (30%) |
CBM_14 | 103..147 | CDD:279884 | 10/55 (18%) | ||
ChtBD2 | 179..218 | CDD:214696 | 10/57 (18%) | ||
CG43896 | NP_001261732.1 | CBM_14 | 96..147 | CDD:279884 | |
CBM_14 | 153..206 | CDD:279884 | 12/38 (32%) | ||
CBM_14 | 211..257 | CDD:279884 | 14/59 (24%) | ||
CBM_14 | 298..343 | CDD:279884 | 11/49 (22%) | ||
CBM_14 | 354..395 | CDD:279884 | 5/15 (33%) | ||
CBM_14 | 427..468 | CDD:279884 | |||
ChtBD2 | 488..535 | CDD:214696 | |||
CBM_14 | 544..593 | CDD:279884 | |||
CBM_14 | <1320..1361 | CDD:279884 | |||
ChtBD2 | 1627..1675 | CDD:214696 | |||
CBM_14 | 1684..1733 | CDD:279884 | |||
ChtBD2 | 1752..1797 | CDD:214696 | |||
CBM_14 | 1820..1868 | CDD:279884 | |||
CBM_14 | 1896..1939 | CDD:279884 | |||
ChtBD2 | 2046..2091 | CDD:214696 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |