DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG11570

DIOPT Version :10

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:120 Identity:32/120 - (26%)
Similarity:48/120 - (40%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKV-DPN-SVAA 172
            |||..|: |..|..:||.|...|.:.:..:.|::.    |:.|        |.|.: .|| .|..
  Fly    55 DCSKYYV-CQKGRAYEQQCPLNLFWSQMTYRCDYK----EYSN--------CNTYIPSPNHDVEV 106

  Fly   173 RFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCEDPEYASGSCAN 227
            .|..:|     |||.|..     ..|::.|.::..:......|..|:|  |.|.|
  Fly   107 IFSAYP-----GDCRRFY-----ETRILRCEQNLQWSSVYQRCVVPQY--GDCQN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:426342
CBM_14 103..147 CDD:426342 11/36 (31%)
ChtBD2 179..218 CDD:214696 7/38 (18%)
CG11570NP_001356902.1 CBM_14 51..93 CDD:426342 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.