DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG7248

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:88/233 - (37%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPE---CPEKYGVQAYAHTENCDQFFLCTN-GTLTLETCENGLLFD---GKGAVHNHCNYNWAVD 82
            ||:   |....|:. ..:.|||..:..||: .:..:..|.:...||   ||      |.:..:.:
  Fly   538 SPDTQICSNSTGLN-LPYQENCQWYIYCTDENSYMMGICGSEEYFDPWTGK------CGFGVSPE 595

  Fly    83 -CKGRQW----------DPTPISTPA--------CE--YQFGLYAVSKDCSTTYIKCAHGEPHEQ 126
             |:..|.          .||.:.||:        |:  .:..|.....||| .:|:|...:|...
  Fly   596 ACREIQTTSPTVTDSTEGPTTVITPSTPGSEPDPCDGAPEGKLVPYPDDCS-KFIQCIQPDPIVY 659

  Fly   127 DCDAGLAYDERIHGCNWPDQLLEHCNPEA--VVGFKCPT------KVDPNSVAARFWPFPRFPVA 183
            ||..|..:...:..|..|  ...:|:..|  :.....||      |..||.:.|........|..
  Fly   660 DCREGQEFSAALERCMAP--WFANCSIPATTIPPVTIPTTTTTTEKPSPNGICADKAEGSLVPYP 722

  Fly   184 GDCHRLITCVEGHPRLISCGEDKVFDEHTLTCEDPEYA 221
            |:|.:.|.|.:..|...:|.|.:.|:...|||.||..|
  Fly   723 GNCSKYIACEDPIPVGYACPEGEEFNPIILTCTDPHLA 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 11/51 (22%)
CBM_14 103..147 CDD:279884 12/43 (28%)
ChtBD2 179..218 CDD:214696 12/38 (32%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884 13/59 (22%)
CBM_14 630..678 CDD:279884 13/50 (26%)
CBM_14 710..758 CDD:279884 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.