DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG5897

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:250 Identity:53/250 - (21%)
Similarity:85/250 - (34%) Gaps:87/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQVCSVLILA--------------WIACGHALAVGSP-ECPEKYGVQAYAHTENCDQFFLCTNGT 53
            |.:|.:|.:.              |...|:   :|.| :|      ||:.:.::        |..
  Fly     8 FHLCVILAIVAEIRGFSMEDKCKLWAGTGY---IGDPSDC------QAWGYCQD--------NKL 55

  Fly    54 LTLETCENGLLF---DG--KGAVHNHCNYNWAVDCKGRQ-WDPTPISTPACEYQFGLYAVSKDCS 112
            :...:|..|||:   ||  |.|....|:...:..|...: |:  .::.||            || 
  Fly    56 IDRRSCTEGLLYSFRDGTCKRASDTICHSQLSEICASLEPWN--YVANPA------------DC- 105

  Fly   113 TTYIKCAH-GEPHEQDCDAGLAYD-------ERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNS 169
            ..::|||. .:|...||..|..:.       |.:.||. .|.:..|....:.||       ||.|
  Fly   106 RRFVKCADLDDPTWGDCGVGQVFSNKKQTCLEEVAGCP-QDNICSHMKDGSFVG-------DPKS 162

  Fly   170 VAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCED--PEYAS 222
                            |.....|..|...:::|...:.|:..|..|:.  |.|.|
  Fly   163 ----------------CQIYYKCHNGFGTMLNCSVGRYFNRKTGNCQSWMPHYCS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 11/51 (22%)
CBM_14 103..147 CDD:279884 13/51 (25%)
ChtBD2 179..218 CDD:214696 7/40 (18%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 12/68 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.