DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and Muc68D

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:203 Identity:56/203 - (27%)
Similarity:84/203 - (41%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPTP----------IST 95
            ::|:::::|.||......|...|.||.|..|   ||:...|||   ..|..|          .||
  Fly  1327 QSCNKYYVCLNGKAIAGHCPRNLHFDIKRKV---CNFPSLVDC---PLDEAPENVTKKPSDTEST 1385

  Fly    96 PACE-YQFGLYAVS-KDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPE---- 154
            |.|: .:.|.|... |.||..|: ||:|....:.|..||.:|.:.:.||:|  :|..|:.|    
  Fly  1386 PDCKSLRNGAYVRDPKSCSRFYV-CANGRAIPRQCPQGLHFDIKSNFCNYP--ILVQCSLEESQA 1447

  Fly   155 ----AVVGFKCP--TKVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTL 213
                |::....|  |||..::         ||......::...|::|...|..|.....||..:.
  Fly  1448 DAHGALLAEGVPDCTKVKEDT---------RFGDVKQHNKYYVCLKGKAVLHYCSPGNWFDLRSQ 1503

  Fly   214 TCEDPEYA 221
            .|.|...|
  Fly  1504 KCIDQRLA 1511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 13/41 (32%)
CBM_14 103..147 CDD:279884 16/44 (36%)
ChtBD2 179..218 CDD:214696 9/38 (24%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 13/41 (32%)
CBM_14 1388..1440 CDD:279884 18/54 (33%)
ChtBD2 1459..1505 CDD:214696 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.