DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG13312

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:289 Identity:63/289 - (21%)
Similarity:93/289 - (32%) Gaps:91/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RFQVCSVLILAWIA---C--GHALAVGSPE--C-PEKYGVQAYAHTENCD-----QFFLCTN--- 51
            :.|.|.|.:|:...   |  |:....||..  | ||.....:.|..:.|:     |.|.||.   
  Fly    46 QMQSCQVDVLSTATPTDCPSGYVCVSGSSGVLCQPEDSASDSQADCQECNKCDETQTFACTGTQS 110

  Fly    52 -----GTLTLE----TCENGLLFDGKGAVHNHCNYNWAVDCKGRQWD---PT------------- 91
                 ||.|::    ||.:|.:          ||.|....| |...|   ||             
  Fly   111 FALCLGTDTVQDSVGTCASGYV----------CNINDTQIC-GLPADGVMPTCSYSDDSTTTTVS 164

  Fly    92 ----------PISTPACEY-----QFGLYAVSKDCSTT---YIKCA------HGEPHEQDCDAGL 132
                      |.::.|..|     ..|.|||..:..||   ||.|.      .|:.:  .|...:
  Fly   165 STTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQTY--TCPGSM 227

  Fly   133 AYDERIHGCNWPDQLLEHCNPEAVVG---FKCPTKVDPNSVAARFWPFPRFPVAGD----CHRLI 190
            .:|.....|  ...:...|:..|...   ...||..:|.:..........:||..|    ||:.|
  Fly   228 YFDSASEMC--VSTMPSTCSTTATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYI 290

  Fly   191 TC-VEGHP---RLISCGEDKVFDEHTLTC 215
            .| :.|..   .:.:|.....::..:.||
  Fly   291 DCFLNGGTWGGNMYTCPGSLYYNSASRTC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 15/63 (24%)
CBM_14 103..147 CDD:279884 13/52 (25%)
ChtBD2 179..218 CDD:214696 11/45 (24%)
CG13312NP_648260.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.