Sequence 1: | NP_523418.1 | Gene: | Peritrophin-A / 33023 | FlyBaseID: | FBgn0022770 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647965.3 | Gene: | CG4835 / 38619 | FlyBaseID: | FBgn0035607 | Length: | 1224 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 70/201 - (34%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 HTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDC------KGRQWDPTPISTPA 97
Fly 98 CEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHG------CNWPDQLLEHCN---P 153
Fly 154 EAVVGFK---CPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTC 215
Fly 216 EDPEYA 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Peritrophin-A | NP_523418.1 | CBM_14 | 36..83 | CDD:279884 | 14/43 (33%) |
CBM_14 | 103..147 | CDD:279884 | 9/49 (18%) | ||
ChtBD2 | 179..218 | CDD:214696 | 14/38 (37%) | ||
CG4835 | NP_647965.3 | CBM_14 | 51..103 | CDD:279884 | 14/43 (33%) |
CBM_14 | 185..237 | CDD:279884 | 20/61 (33%) | ||
CBM_14 | 273..322 | CDD:279884 | |||
CBM_14 | 393..444 | CDD:279884 | |||
CBM_14 | 485..539 | CDD:279884 | |||
CBM_14 | 585..638 | CDD:279884 | |||
CBM_14 | 661..714 | CDD:279884 | |||
CBM_14 | 744..796 | CDD:279884 | |||
CBM_14 | 914..962 | CDD:279884 | |||
CBM_14 | 1175..1212 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |