DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG32302

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:250 Identity:46/250 - (18%)
Similarity:77/250 - (30%) Gaps:98/250 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QVCSVLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQ--------------------FFLC 49
            ::||      ...|::...|:...|.:        :|.|.|                    |::|
  Fly   120 RICS------NGAGYSTLTGTCVLPRE--------SEQCIQEQFTCSRSGQVGGWAPDNRYFYVC 170

  Fly    50 TNGTLT-----LETCENGLLFDGKG------------AVHNH-CNYNWAVDCKGRQWDPTPISTP 96
            .|.|..     :..|..|.:|:...            |:.:| |..|....|        |..|.
  Fly   171 VNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQC--------PFRTS 227

  Fly    97 ACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKC 161
            ..||          |     ||..||.....|.||...|.:|..| ..|::.: |:...::  .|
  Fly   228 EIEY----------C-----KCVDGELEVMTCPAGFQIDPKILTC-VTDRIYQ-CSDFEIL--SC 273

  Fly   162 PTKVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCE 216
            |      :|:.:             .....|::...::.||...:.|:..|..|:
  Fly   274 P------NVSTK-------------DEYCICIDHQLQIYSCPMGQYFNAETRKCQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 14/84 (17%)
CBM_14 103..147 CDD:279884 12/43 (28%)
ChtBD2 179..218 CDD:214696 6/37 (16%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.