DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and obst-B

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:212 Identity:66/212 - (31%)
Similarity:99/212 - (46%) Gaps:21/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPT 91
            ||||..|.  |..::.||:::.|.:|..|...|.:|::|:....:...|:..:.:||..|....|
  Fly    85 ECPEPNGF--YPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQT 147

  Fly    92 PISTPACEYQFGLYAVSKD--CSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQL-LEHCNP 153
            |..:..|..:.|.:...|.  |...|. |..|:.:...|.|||.::.:...|.||||: :..|..
  Fly   148 PQPSLHCPRKNGYFGHEKPGICDKFYF-CVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCKS 211

  Fly   154 EAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVEGH-PRLISCGEDKVFDEHTLTCE- 216
            |.|..|:|| ||: .|:|.   ..||:....||.....||.|. ||...|...:||||...||: 
  Fly   212 EDVFDFECP-KVN-ESIAV---THPRYADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETCDW 271

  Fly   217 ---DPEYASGSCANYGK 230
               .|:     ||::.|
  Fly   272 ARKVPD-----CADWYK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/46 (22%)
CBM_14 103..147 CDD:279884 14/45 (31%)
ChtBD2 179..218 CDD:214696 15/43 (35%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 11/51 (22%)
CBM_14 156..204 CDD:279884 14/48 (29%)
CBM_14 233..278 CDD:279884 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.