DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG34324

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:132 Identity:26/132 - (19%)
Similarity:39/132 - (29%) Gaps:47/132 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCEN-GLLFDG--------------KGAVHNH 74
            :|.|           |..|.....||....|....:| |.:.||              :..:..|
  Fly   154 TPPC-----------TPPCTTTKPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRH 207

  Fly    75 CNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIH 139
                   ||:|:: |.|            ..|..:.|...|: |.......|:|..|..:|..:.
  Fly   208 -------DCRGQE-DGT------------FLADVRHCRRYYV-CNRQRSKRQNCPNGYWFDRELK 251

  Fly   140 GC 141
            .|
  Fly   252 AC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/61 (16%)
CBM_14 103..147 CDD:279884 9/39 (23%)
ChtBD2 179..218 CDD:214696
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.