Sequence 1: | NP_523418.1 | Gene: | Peritrophin-A / 33023 | FlyBaseID: | FBgn0022770 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_733185.2 | Gene: | CG31077 / 318583 | FlyBaseID: | FBgn0051077 | Length: | 988 | Species: | Drosophila melanogaster |
Alignment Length: | 232 | Identity: | 51/232 - (21%) |
---|---|---|---|
Similarity: | 74/232 - (31%) | Gaps: | 73/232 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 SPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWD 89
Fly 90 PTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPE 154
Fly 155 AVVGFKCPT----------KVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFD 209
Fly 210 -------------------EHTLTCEDPEYASGSCAN 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Peritrophin-A | NP_523418.1 | CBM_14 | 36..83 | CDD:279884 | 13/46 (28%) |
CBM_14 | 103..147 | CDD:279884 | 12/43 (28%) | ||
ChtBD2 | 179..218 | CDD:214696 | 9/57 (16%) | ||
CG31077 | NP_733185.2 | CBM_14 | 43..81 | CDD:279884 | |
ChtBD2 | <212..245 | CDD:214696 | 11/35 (31%) | ||
CBM_14 | 267..308 | CDD:279884 | 13/48 (27%) | ||
CBM_14 | 439..472 | CDD:279884 | |||
CBM_14 | 733..769 | CDD:279884 | |||
CBM_14 | 881..914 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |