DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and CG31077

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:74/232 - (31%) Gaps:73/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWD 89
            |.||.:.   :......||..:|.|.||.|..:||.:|..|:   ..:..|    .||.||...:
  Fly   201 SSECTDG---EVRVDPNNCAGYFNCENGRLITKTCPSGTYFE---PTYKTC----TVDLKGVCVE 255

  Fly    90 PTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPE 154
            |....|.      |...:..:....|:||..||..|:.|..|..||.::..|     |::   .|
  Fly   256 PPAKCTE------GQLKIDPNNCAGYLKCIDGEFVEEKCPGGTYYDFKLETC-----LVD---TE 306

  Fly   155 AVVGFKCPT----------KVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISCGEDKVFD 209
            .|    |.|          :.||.                ||.....|:.|....:.|...:.|:
  Fly   307 GV----CVTIRKLCIEGLREKDPK----------------DCAAYTQCIRGRVESVMCDSGRYFN 351

  Fly   210 -------------------EHTLTCEDPEYASGSCAN 227
                               ||....|..:|...:..|
  Fly   352 VTQGECLADLYEVCLKSRKEHFRIVEHHQYDESTTPN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 13/46 (28%)
CBM_14 103..147 CDD:279884 12/43 (28%)
ChtBD2 179..218 CDD:214696 9/57 (16%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 11/35 (31%)
CBM_14 267..308 CDD:279884 13/48 (27%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.