Sequence 1: | NP_523418.1 | Gene: | Peritrophin-A / 33023 | FlyBaseID: | FBgn0022770 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498171.1 | Gene: | R02F2.4 / 175755 | WormBaseID: | WBGene00019833 | Length: | 431 | Species: | Caenorhabditis elegans |
Alignment Length: | 255 | Identity: | 51/255 - (20%) |
---|---|---|---|
Similarity: | 93/255 - (36%) | Gaps: | 75/255 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPTPIST 95
Fly 96 PACEYQFGLYAVSK-DCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLL---------EH 150
Fly 151 C--------------------NPEAVVGFKCPTKV---DPNSVAARFWPFPRFPV---------- 182
Fly 183 ----------------AGDC-HRLITCVEGHPRLISCGEDKVFDEHTLTCEDPEYASGSC 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Peritrophin-A | NP_523418.1 | CBM_14 | 36..83 | CDD:279884 | 7/46 (15%) |
CBM_14 | 103..147 | CDD:279884 | 14/44 (32%) | ||
ChtBD2 | 179..218 | CDD:214696 | 12/65 (18%) | ||
R02F2.4 | NP_498171.1 | CBM_14 | 25..74 | CDD:279884 | |
ChtBD2 | 117..165 | CDD:214696 | 10/46 (22%) | ||
CBM_14 | 185..229 | CDD:279884 | 14/43 (33%) | ||
ChtBD2 | 240..283 | CDD:214696 | 6/43 (14%) | ||
CBM_14 | 310..361 | CDD:279884 | 14/50 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |