DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and R02F2.4

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:255 Identity:51/255 - (20%)
Similarity:93/255 - (36%) Gaps:75/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDPTPIST 95
            |.||  |:.......:.:|.:|:....:|...|::|   ..:..|::...:|      :.:.:|.
 Worm   123 KDGV--YSSGTCSSSYIICNSGSPRFLSCSTPLIYD---PTNKKCSWKGMID------ECSQVSG 176

  Fly    96 PACEYQFGLYAVSK-DCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLL---------EH 150
            ..||....   :|| :||..:..|:.|..|.::|.|.|.::..|..|:||..::         ::
 Worm   177 EYCESDGN---ISKSECSNVFFSCSEGIAHRRNCPANLVFNPAISSCDWPKNVMDCSEKSEKPQN 238

  Fly   151 C--------------------NPEAVVGFKCPTKV---DPNSVAARFWPFPRFPV---------- 182
            |                    |...:|.| ||..:   :.|.:....|......:          
 Worm   239 CGEVDGYFSFGRCSSSFSACTNGIPIVMF-CPDGLMFSEKNQMCDYEWNVDECDLESSGFMENYK 302

  Fly   183 ----------------AGDC-HRLITCVEGHPRLISCGEDKVFDEHTLTCEDPEYASGSC 225
                            |.|| .|:::|..|...:..|....||:|::|.|:.||.:...|
 Worm   303 ASEALTPCTNMDNGLYALDCTPRVLSCQNGRENIFECPPSLVFNENSLICDYPETSLKCC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 7/46 (15%)
CBM_14 103..147 CDD:279884 14/44 (32%)
ChtBD2 179..218 CDD:214696 12/65 (18%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 10/46 (22%)
CBM_14 185..229 CDD:279884 14/43 (33%)
ChtBD2 240..283 CDD:214696 6/43 (14%)
CBM_14 310..361 CDD:279884 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.