DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and cpg-1

DIOPT Version :9

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:135 Identity:38/135 - (28%)
Similarity:50/135 - (37%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHN 73
            ||:...:|..:|          :|||...  .||           |.|||.......||.||.:.
 Worm     6 VLLAFLVASAYA----------QYGVAGM--YEN-----------LPLETTTLDGSGDGSGADNG 47

  Fly    74 HCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERI 138
            ..:        |.  |...|.|.....:.||||:. .||..::.|:.|.....||.|.|.||.||
 Worm    48 FVS--------GA--DAVAIDTDCSTKEDGLYAIG-GCSPQFLTCSGGISRIMDCPADLIYDPRI 101

  Fly   139 HGCNW 143
            ..|.:
 Worm   102 VACEY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/46 (22%)
CBM_14 103..147 CDD:279884 17/41 (41%)
ChtBD2 179..218 CDD:214696
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 17/47 (36%)
CBM_14 214..266 CDD:279884
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.