DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and cpg-1

DIOPT Version :10

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:135 Identity:38/135 - (28%)
Similarity:50/135 - (37%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLILAWIACGHALAVGSPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHN 73
            ||:...:|..:|          :|||...  .||           |.|||.......||.||.:.
 Worm     6 VLLAFLVASAYA----------QYGVAGM--YEN-----------LPLETTTLDGSGDGSGADNG 47

  Fly    74 HCNYNWAVDCKGRQWDPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERI 138
            ..:        |.  |...|.|.....:.||||:. .||..::.|:.|.....||.|.|.||.||
 Worm    48 FVS--------GA--DAVAIDTDCSTKEDGLYAIG-GCSPQFLTCSGGISRIMDCPADLIYDPRI 101

  Fly   139 HGCNW 143
            ..|.:
 Worm   102 VACEY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:426342 10/46 (22%)
CBM_14 103..147 CDD:426342 17/41 (41%)
ChtBD2 179..218 CDD:214696
cpg-1NP_001021159.1 CBM_14 61..113 CDD:426342 17/47 (36%)
rne <116..206 CDD:236766
CBM_14 214..266 CDD:426342
rne <321..499 CDD:236766
CBM_14 <539..576 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.