DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Peritrophin-A and LOC1279248

DIOPT Version :10

Sequence 1:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_318942.4 Gene:LOC1279248 / 1279248 VectorBaseID:AGAMI1_001027 Length:89 Species:Anopheles gambiae


Alignment Length:58 Identity:20/58 - (34%)
Similarity:30/58 - (51%) Gaps:11/58 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDP 167
            || |.:.||.:|:.:|.||.|||.::.....|::|    |..|.|.      |.::||
Mosquito    43 DC-TKFYKCFNGKKYEMDCPAGLHWNIEKDFCDFP----EEANCER------PLQIDP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:426342
CBM_14 103..147 CDD:426342 14/36 (39%)
ChtBD2 179..218 CDD:214696
LOC1279248XP_318942.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.