DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP011614

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001689300.1 Gene:AgaP_AGAP011614 / 5668000 VectorBaseID:AGAP011614 Length:292 Species:Anopheles gambiae


Alignment Length:197 Identity:47/197 - (23%)
Similarity:71/197 - (36%) Gaps:43/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKN----- 97
            |.|:..|...||..:.||...:||        .|:   :.|       .|.:.:.|.::.     
Mosquito   100 CYKYISCYKEVATEETCPPDTIFD--------LDE---ITC-------VP
GNQRTCRKEGDPYPL 146

  Fly    98 ----------GFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQ 152
                      |...||:.  ||.:.:|:.|.|.|..|..|..|.|....|:..|.   ..|....
Mosquito   147 PTDMCRGIVLGTMVHPED--CNKYVSCLLGQARERSCRPGFVFSERLFVCLPGDL---NSCTVTL 206

  Fly   153 RTSETGFVCPKD-QPKTDD--RGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATE 214
            ..: |..:.|:| :|...|  |...|.....|||..|.|:..|... .|.:..|...:|:::...
Mosquito   207 LPT-TSTIAPEDIRPLPSDICRRNSVAFGVLPHPQFCTKYVTCTLW-IPAERDCDRFKVFSERFS 269

  Fly   215 MC 216
            ||
Mosquito   270 MC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 10/38 (26%)
CBM_14 95..143 CDD:366726 15/62 (24%)
CBM_14 180..225 CDD:366726 11/37 (30%)
AgaP_AGAP011614XP_001689300.1 ChtBD2 84..131 CDD:214696 11/48 (23%)
CBM_14 151..196 CDD:279884 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.