DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG42296

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster


Alignment Length:250 Identity:51/250 - (20%)
Similarity:91/250 - (36%) Gaps:62/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TVSAANFECPKPNGQFADEVQCDKFYV-----------CDDGVAKA-------------KLCPDG 57
            |.|......|:|...|..::..|:..:           .|:.:.||             ...|..
  Fly   589 TESYPTMNIPRPMDMFPGQIDADRVSIRPNSQKIESMEMDEDMIKANYQSGSGIGNGNGNTLPHV 653

  Fly    58 LVFDPLNRKFNKCDQPFNVDCEDRTELQEPK--SSKYCPRKNGFFAHPDPAVCNIFYNCIEGDAL 120
            |.:   :...::...|.|...|....||:|:  ...|.||       |.|.:.:..|:..:|:..
  Fly   654 LTY---SSDMSQQLAPSNGYLEQSYSLQQPQHHHHPYMPR-------PRPTMSSSIYSDSDGNME 708

  Fly   121 ETKCTVGLHFDEYSGTCV-WPDTAKREGCNPEQRTSETG-FV------------CPKDQPKTDDR 171
            .:..|...:.:.:.|..| :|.:....|    |..:..| |:            ..|.....::.
  Fly   709 MSMFTSSPNLNPFKGGNVKYPGSTSPNG----QLVNFNGNFISLDVFQKSILPLMTKSPSALNEL 769

  Fly   172 G--QVVT---HPKYPHPTDCQKFYVCLNGEDPRDL--GCQLGEVYNDATEMCDAP 219
            |  :|:|   ..:.|:.|||.:::|| :.:|.:.|  .|.....:|..|.:||||
  Fly   770 GNVEVITCQAGVRQPNQTDCTRYFVC-SKKDGKVLSYSCPPYTAFNKQTRICDAP 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 10/73 (14%)
CBM_14 95..143 CDD:366726 9/48 (19%)
CBM_14 180..225 CDD:366726 14/41 (34%)
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696
CBM_14 784..828 CDD:279884 14/40 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.