DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP009022

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001238192.2 Gene:AgaP_AGAP009022 / 4578142 VectorBaseID:AGAP009022 Length:2402 Species:Anopheles gambiae


Alignment Length:318 Identity:64/318 - (20%)
Similarity:101/318 - (31%) Gaps:108/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLCVATTV--------SAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKF 67
            |....||:        ..:|.|..:.|...|....|:.:|.|.....|.:.|..||.:   |...
Mosquito   664 TTTTGTTIPVPGLVMPELSNAESCEGNQYKAHPTNCNSYYRCVLSEFKQQFCAGGLHW---NDAA 725

  Fly    68 NKCDQPFNVDCE--------------------DRTELQ-------------------EPKSSKYC 93
            ..||.|.:..||                    .||..:                   ||.:|:..
Mosquito   726 KLCDWPASARCEMDEGTQGPDTTTTTTTTPKPTRTSSRRTTTSRTTTPTTTTTITTPEPMTSRPT 790

  Fly    94 PRK--------------------------------NG-FFAHPDPAVCNIFYNCIEGDALETKCT 125
            .||                                || ::.|..   |:.||.|:....:..:|.
Mosquito   791 RRKTTLASNTPTQRPTKKPATTTKKPVSRPAEPCTNGEYYPHKS---CDSFYICVNEKKVAQQCG 852

  Fly   126 VGLHFDEYSGTCVWPDTAKREGC-NPEQ--RTSETGF----VCPKDQPKTDDRGQVVTHPKYPHP 183
            .||::.:...:|.|.:..   .| :.||  |...|.|    ...:|.| .|....|      |:|
Mosquito   853 PGLYWSQTDKSCDWEENV---NCVSNEQYFRLLTTTFGALKALSEDDP-CDGNSHV------PYP 907

  Fly   184 TDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENVP----GCEDWYKDVDDKKD 237
            .||.::.|| |........|..|..:|...::||.|.:..    |..:..:::.|:.:
Mosquito   908 GDCSQYLVC-NWGRLEAASCADGLHWNQQLKICDWPASAKCSQGGIPESTENISDENN 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/49 (27%)
CBM_14 95..143 CDD:366726 14/80 (18%)
CBM_14 180..225 CDD:366726 13/48 (27%)
AgaP_AGAP009022XP_001238192.2 Glyco_18 193..538 CDD:214753
GH18_chitolectin_chitotriosidase 194..559 CDD:119351
ChtBD2 687..731 CDD:214696 12/46 (26%)
CBM_14 824..872 CDD:279884 12/53 (23%)
CBM_14 898..947 CDD:279884 15/55 (27%)
Glyco_18 1011..1355 CDD:214753
GH18_chitolectin_chitotriosidase 1012..1376 CDD:119351
Glyco_18 1438..1782 CDD:214753
GH18_chitolectin_chitotriosidase 1439..1803 CDD:119351
CBM_14 1897..1944 CDD:279884
Glyco_18 2025..2369 CDD:214753
GH18_chitolectin_chitotriosidase 2026..2390 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.