DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment obst-A and AgaP_AGAP009479

DIOPT Version :9

Sequence 1:	NP_001245778.1	Gene:	obst-A / 33022	FlyBaseID:	FBgn0031097	Length:	237	Species:	Drosophila melanogaster
Sequence 2:	XP_001230737.2	Gene:	AgaP_AGAP009479 / 4578026	VectorBaseID:	AGAP009479	Length:	777	Species:	Anopheles gambiae

Alignment Length:	71	Identity:	23/71 - (32%)
Similarity:	32/71 - (45%)	Gaps:	7/71 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 VSAANFECPKP--NGQFAD-EVQCDKFYVCDDGVAKAK-LCPDGLVFDPLNRKFNKCDQPFNVDC 78
            :...:|.|.:.  .|.|.| |..|..::.||....||. |||:|.:|..:..   .||..|||.|
Mosquito   474 IPETSFSCKEQRYKGFFGDPETNCQVWHYCDLNGGKASFLCPNGTIFSQVAL---TCDWWFNVKC 535

  Fly    79 EDRTEL 84
            ....:|
Mosquito   536 STTAQL 541

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
obst-A	NP_001245778.1	CBM_14	27..77	CDD:366726	18/53 (34%)
		CBM_14	95..143	CDD:366726
		CBM_14	180..225	CDD:366726
AgaP_AGAP009479	XP_001230737.2	CBM_14	481..535	CDD:279884	20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910