DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP010466

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001230800.2 Gene:AgaP_AGAP010466 / 4577919 VectorBaseID:AGAP010466 Length:685 Species:Anopheles gambiae


Alignment Length:232 Identity:61/232 - (26%)
Similarity:89/232 - (38%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATTVSAANFECPKPNG--QFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKF---------N 68
            |...|..|..|...||  .....:.|.::::|.|..:..:.||.|.|||...:..         .
Mosquito   361 APAPSNPNNPCRNNNGITYKPHAIDCTRYFMCMDTQSIERSCPSGQVFDIYVKACESTSVCILDQ 425

  Fly    69 KCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEY 133
            |..:|.............|..:. |....|....|.|..||.:|.|::..|||..|..|..||.|
Mosquito   426 KPSEPIPTTLPPSPTTPSPAINP-CANNVGIAYLPHPQDCNRYYMCMDSQALERSCAFGEIFDIY 489

  Fly   134 SGTC---------VWPDTAKREGCNPEQRTSETG----FVCPKDQPKTDDRGQVVTHPKYPHPTD 185
            ..||         :.|......|..|:..||...    ||||  :|..:          :||||:
Mosquito   490 KTTCGPSETSSCILNPTPTSTPGDIPKPPTSPPNLNPLFVCP--EPTGN----------FPHPTN 542

  Fly   186 CQKFYVCLNGED-PRDLGCQLGEVYNDATEMCDAPEN 221
            |..:|:|:|.:. .|:.|..|  |::.....|:.||:
Mosquito   543 CNLYYLCINSQSFQRECGPNL--VFDIQIMQCNRPED 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/60 (22%)
CBM_14 95..143 CDD:366726 18/56 (32%)
CBM_14 180..225 CDD:366726 15/43 (35%)
AgaP_AGAP010466XP_001230800.2 CBM_14 17..68 CDD:279884
ChtBD2 71..121 CDD:214696
ChtBD2 144..189 CDD:214696
CBM_14 213..252 CDD:279884
ChtBD2 272..318 CDD:214696
ChtBD2 378..415 CDD:214696 9/36 (25%)
ChtBD2 447..493 CDD:214696 16/46 (35%)
ChtBD2 528..575 CDD:214696 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.