DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP011619

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001238397.2 Gene:AgaP_AGAP011619 / 4577643 VectorBaseID:AGAP011619 Length:864 Species:Anopheles gambiae


Alignment Length:238 Identity:57/238 - (23%)
Similarity:85/238 - (35%) Gaps:65/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDC------------------------ 78
            ||::.||:...|..:.|.|||:|   ...|..|.....|.|                        
Mosquito   101 CDRYLVCNKEKATIERCEDGLIF---IADFISCSPGSKVTCTAEPDEPTTQSTVVEPEPTFPTTE 162

  Fly    79 EDRTELQEPKSS---KYCPRKN--GFFAHPDPAVCNIFYNCIEGDALETKCTVG------LH--F 130
            |..:|....:||   .|...|.  |..|||:  .|:.:.:|.:..|.|..|..|      ||  .
Mosquito   163 ESGSEEDSSESSGTYDYLCAKTLVGSVAHPE--TCHKYISCYKYKAKEQSCKKGYAYTSKLHLCI 225

  Fly   131 DEYSGTCVWPDTAKREGCNPEQRTSETG---FVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVC 192
            .:..|.|  ||..:.|  :..|.|..:|   ::|.|...     |.|.      ||..|.|:..|
Mosquito   226 KQKKGAC--PDDVEEE--STTQSTVSSGTYDYLCAKTLV-----GSVA------HPETCNKYISC 275

  Fly   193 LNGEDPRDLGCQLGEVYNDATEMCDAPENVPGCEDWYKDVDDK 235
            ...: .::..|:.|..|.....:| ..:....|.|   ||:::
Mosquito   276 YKNK-AKEQSCKKGYAYTSKLHLC-IKQKKGACPD---DVEEE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 12/38 (32%)
CBM_14 95..143 CDD:366726 17/57 (30%)
CBM_14 180..225 CDD:366726 9/44 (20%)
AgaP_AGAP011619XP_001238397.2 CBM_14 3..50 CDD:279884
CBM_14 811..854 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.