DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP002457

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001237469.3 Gene:AgaP_AGAP002457 / 4577133 VectorBaseID:AGAP002457 Length:571 Species:Anopheles gambiae


Alignment Length:219 Identity:49/219 - (22%)
Similarity:76/219 - (34%) Gaps:69/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VQCDKFY-VCDDGVAKAKLCPDGL----VFDPL-----NRKFNKCDQPFNVDCEDRTELQEPKSS 90
            :..|.|: :|....|..|:..||:    |.:|.     ..::|:.....:.|.|..|......::
Mosquito   375 IDMDDFHGLCGPENALMKVLYDGMKDYVVPEPTVTTTPRPEWNRPPSTMSSDGEQTTARPATTTT 439

  Fly    91 KYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTS 155
            .|.||       |...|           |..|:.|                ||:|.....:..| 
Mosquito   440 TYKPR-------PTTTV-----------APTTRTT----------------TARRTTTTRKPTT- 469

  Fly   156 ETGFVCPKDQPKTDDRGQVVTHPKYPH-----------------PTDCQKFYVCLNGEDPRDLGC 203
                :.|.|....:||.:....|..|.                 ..||.|:|.|::|: |.:..|
Mosquito   470 ----ILPPDTDSEEDREEPAMPPAAPEREDESEIDCSGYKDFVPSVDCTKYYRCVHGQ-PVEFVC 529

  Fly   204 QLGEVYNDATEMCDAPENV--PGC 225
            :.|.|::.|..:||.|||.  |.|
Mosquito   530 KPGTVFHTALNVCDWPENADRPEC 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 10/50 (20%)
CBM_14 95..143 CDD:366726 6/47 (13%)
CBM_14 180..225 CDD:366726 18/63 (29%)
AgaP_AGAP002457XP_001237469.3 Glyco_18 27..378 CDD:214753 0/2 (0%)
GH18_chitinase-like 28..396 CDD:299167 5/20 (25%)
CBM_14 501..553 CDD:279884 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.