DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP006432

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001237816.1 Gene:AgaP_AGAP006432 / 4576210 VectorBaseID:AGAP006432 Length:373 Species:Anopheles gambiae


Alignment Length:317 Identity:54/317 - (17%)
Similarity:72/317 - (22%) Gaps:185/317 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CPRKNG----FFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQR 153
            ||...|    :|.|  |..|:.||.|...||.|.:|..||||:.....|.:|..||.|..:|..:
Mosquito    34 CPEMQGPLPHYFIH--PTNCSRFYECHMKDAWEYECPAGLHFNVAIDVCDFPVNAKCESQSPGDQ 96

  Fly   154 TS--------------------------------------------------------------- 155
            |:                                                               
Mosquito    97 TTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITTTTPIWTD 161

  Fly   156 ETGFVCP------KDQPK----------TDDRGQVVTH--------------------------- 177
            .|.:..|      .|||:          ||......||                           
Mosquito   162 PTTWSAPTTTTTWSDQPRPPTTTTTTVWTDPTATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPT 226

  Fly   178 ----------------------------------------------------PKYPHP------- 183
                                                                |..|||       
Mosquito   227 ATTTTHAPTTTTTWSDLPPPPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPHPTDPHCPP 291

  Fly   184 ------------TDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDA-PENVPGCED 227
                        |||.::|.||.| ..::..|..|..:||..:.||: ..:..||.|
Mosquito   292 PGATLPNYWAHGTDCSRYYGCLEG-CVKEFKCPDGLYWNDQQKRCDSYSSSQCGCPD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726
CBM_14 95..143 CDD:366726 18/51 (35%)
CBM_14 180..225 CDD:366726 16/64 (25%)
AgaP_AGAP006432XP_001237816.1 ChtBD2 38..83 CDD:214696 17/46 (37%)
ChtBD2 287..336 CDD:214696 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.