DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and AgaP_AGAP006433

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_001237817.1 Gene:AgaP_AGAP006433 / 4576208 VectorBaseID:AGAP006433 Length:294 Species:Anopheles gambiae


Alignment Length:241 Identity:58/241 - (24%)
Similarity:89/241 - (36%) Gaps:77/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PKPNGQFADEVQCDKFY--VCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPF-------------- 74
            ||.:..|.....|.::|  ||:|  |....||:||.|:|  ||....:.|.              
Mosquito    10 PKTSTLFPHYSDCTRYYECVCND--AYEYECPEGLRFNP--RKLRCEESPLCLEAGAAVDPEQGP 70

  Fly    75 ---NVDCEDRTEL----------------QEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDAL 120
               ..|||:.:.:                :.||:|...|..:.         |..:|.|:...|.
Mosquito    71 PEPQTDCEEASRVAVASDWLSIMPNHWMCEIPKTSTLFPHYSD---------CTRYYKCVCNTAY 126

  Fly   121 ETKCTVGLHFD------EYSGTCVWPDTAKREGCNPEQRTSETGFV---CP-KDQPK--TDDRGQ 173
            |.:|..||.|:      |.|..|.   .|:.|..|......:.|.:   || ::..|  ||::  
Mosquito   127 EYECPEGLGFNQRMLRCEKSSYCA---GAEEEEANHSSGVPDHGALDPRCPTRESVKAWTDEQ-- 186

  Fly   174 VVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAP 219
                       :|.|:|.|.:|: ..|:.|....||:.|.:.|..|
Mosquito   187 -----------NCSKYYQCADGQ-VLDMHCPESLVYDSAAKRCSLP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 17/68 (25%)
CBM_14 95..143 CDD:366726 12/53 (23%)
CBM_14 180..225 CDD:366726 12/40 (30%)
AgaP_AGAP006433XP_001237817.1 ChtBD2 10..51 CDD:214696 17/44 (39%)
CBM_14 103..143 CDD:279884 12/48 (25%)
CBM_14 184..225 CDD:279884 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.