DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Mur89F

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:88/283 - (31%) Gaps:92/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TTVSAANFECP---KPN--------GQFADEVQCDKFYVCDDGVAKAK--------LCPDGLVFD 61
            ||.|::....|   .||        |..||...|.|||.|   |...|        .|..|.|:|
  Fly  1314 TTASSSQTTSPVTQAPNTDGKCRSEGFMADPNNCSKFYRC---VRNNKGGFTSIPFQCGAGTVWD 1375

  Fly    62 PLNRKFNKCDQPFNVDCEDRTELQEPKSSKYC-PRKNGFFA-------HPDPAVCNIFYNCIEGD 118
               :....|:..|| :|...||...||..  | |..||..|       .|.|...:         
  Fly  1376 ---QDLQTCNHNFN-NCSTGTESTTPKPP--CEPATNGTTATSTSSTTTPPPTTTD--------- 1425

  Fly   119 ALETKCTVGL------HFDEYSGTCVWPDTAKR----------------------EGCNPEQRT- 154
             |....|.||      .....:.|.:.|.|..|                      .|..|...| 
  Fly  1426 -LPPTSTTGLPPTTTTELPPTTTTDLPPTTTTRLPPTTTTSLPPTTTTGLPPTTTTGAQPTTTTL 1489

  Fly   155 ---SETGFVCPKDQPKTDDRGQVVTHP-----------KYPHPTDCQKFYVCLN-GEDPR--DLG 202
               :||..|....:..|.........|           ....|.||:|:|.|:| |...|  :..
  Fly  1490 SSETETSTVTTSPESTTQPPSTTTMKPLPAGTECTGEGYMADPEDCRKYYRCINAGASYRKYNFT 1554

  Fly   203 CQLGEVYNDATEMCDAPENVPGC 225
            |..|..:|:..:.||..||:|.|
  Fly  1555 CPKGTGWNEEVQTCDYVENIPRC 1577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 19/65 (29%)
CBM_14 95..143 CDD:366726 11/60 (18%)
CBM_14 180..225 CDD:366726 17/47 (36%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884 17/58 (29%)
CBM_14 1523..1577 CDD:279884 17/53 (32%)
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.