DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and Cht5

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster


Alignment Length:90 Identity:21/90 - (23%)
Similarity:39/90 - (43%) Gaps:9/90 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FNVDCEDRTELQEPKSSKYCPRK-----NGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEY 133
            :.||..:.|:.::|...::.|.:     ..|..||:   |..::.|:.|..:|.:|..|..|...
  Fly   506 YPVDPVEPTDPEQPMGPQFDPNEIDCTNRDFVPHPN---CRKYFRCVHGKPVEFECKEGTAFHTV 567

  Fly   134 SGTCVWPDTAKREGCNPEQRTSETG 158
            ...|.|.:.:.|..|: ..:..|.|
  Fly   568 LNVCDWIENSDRYYCS-RMKNKEKG 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 0/2 (0%)
CBM_14 95..143 CDD:366726 12/52 (23%)
CBM_14 180..225 CDD:366726
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753
GH18_chitolectin_chitotriosidase 29..397 CDD:119351
Trypan_PARP 367..469 CDD:114603
CBM_14 531..578 CDD:279884 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.