DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG17147

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:99/265 - (37%) Gaps:77/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CVATTVSAANF---ECPKPNGQF-ADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQP 73
            ||.|..::..:   .|...:|:: ||..:|.|::.|.:||..|.:||.|..||   .:...|  .
  Fly    76 CVDTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFD---ERSQSC--L 135

  Fly    74 FNVD--CEDRTELQE--PKSSKYCPRKNGFFAHPDPAVCNIFYNCIE-GDALETKCTVGL----H 129
            :.||  |.|...:.|  .:::|:...|:          |..:|.|.: |:.....|||..    :
  Fly   136 YGVDSMCVDVNNICELVAENTKFRNEKD----------CAYYYECDKTGNHASKSCTVTSKKREY 190

  Fly   130 FDEYSGTCVWPDTAKREGCNPEQR----TSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFY 190
            ||..||.||   .|.:..|....:    ||.|......||                  ..|:.::
  Fly   191 FDVESGNCV---EANKVECTAHSKENVCTSSTTMTFKSDQ------------------ATCRGYF 234

  Fly   191 VC-----LNGEDPRDLGCQLGEVYNDATEMCDAPENV-------------------PGCEDWYKD 231
            ||     :...||....|..|..:::..::|..|..|                   ..|.::.:.
  Fly   235 VCKALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHNRCDGRGTMLVTSSSNNCHNYIRC 299

  Fly   232 VDDKK 236
            ||:|:
  Fly   300 VDNKE 304

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 15/50 (30%)
CBM_14 95..143 CDD:366726 14/52 (27%)
CBM_14 180..225 CDD:366726 10/68 (15%)