DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG17145

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:234 Identity:52/234 - (22%)
Similarity:80/234 - (34%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CV---ATTVSAANFECPKPNGQF-ADEVQCDKFYVC-DDGVAKAKLCPDGLVFDPLNRKFNKCDQ 72
            ||   :|:.|:.:..|.....|| ||...|..:|.| |:..|....||....|   |.....|.:
  Fly    75 CVKSLSTSTSSCSISCADRAKQFVADPKSCYGYYYCADEETALYGTCPQETHF---NATTQMCSR 136

  Fly    73 PFNVDCEDRTELQEPKSSKYCP-RKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGT 136
            ....||...|       .:||. .||| ....:...||:::.|.:| .|:.|.....::...:|.
  Fly   137 QHESDCTTST-------FEYCSIVKNG-VNFDNLQGCNMYHVCEKG-VLKDKTCSKTYYQASTGE 192

  Fly   137 CV-----------WPDTAKREGCNP-------EQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHP 183
            ||           .|.....:...|       ::.|....|.|.|.:..|.|          |:|
  Fly   193 CVSKALVDCDAHPLPTDVCGKASKPYENKFVADEATCRGYFYCAKQKDGTPD----------PNP 247

  Fly   184 TDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENV 222
            ...|               |.....::.:::||..|.:|
  Fly   248 VWNQ---------------CPQDRFFDASSQMCITPSSV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 14/51 (27%)
CBM_14 95..143 CDD:366726 13/58 (22%)
CBM_14 180..225 CDD:366726 8/43 (19%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 14/53 (26%)
CBM_14 278..327 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.