DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG6933

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:80/236 - (33%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCAIAVTLCVATTVSAANFE--CPKPN--GQFADEVQCDKFYVC-DDGVAKAKLCPDGLVFDPLN 64
            :|.:|..|.:|:..:....:  |.:.:  |...:...|..:..| :..|.....||:||||   |
  Fly    20 ICVVAACLLMASQATGYTMDDLCQQWSGYGYIGNPSNCHAWGYCKNQEVVAWGTCPNGLVF---N 81

  Fly    65 RKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIE-------GDALET 122
            .:...||......|.  |...|..|:...|.   :.|:|        .||.|       |.....
  Fly    82 AQAGSCDYANTTVCS--TSAVETCSNVKSPM---YVANP--------LNCTEYAYCDGTGQISYG 133

  Fly   123 KCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQ 187
            .|..|..:...|..|:|                  |..||:|   |..| .::::.....|..|.
  Fly   134 DCGTGGVYSASSTKCIW------------------GPACPQD---TICR-FMLSNIFVGDPNQCG 176

  Fly   188 KFYVCLNGEDPRD-LGCQLGEVYNDATEMCDAPENVPGCED 227
            .:..|:||....: ........||.||..|.:.....| ||
  Fly   177 NYINCVNGYGTSEKCSSTANPYYNKATGNCQSTNPCTG-ED 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/52 (25%)
CBM_14 95..143 CDD:366726 11/54 (20%)
CBM_14 180..225 CDD:366726 10/45 (22%)
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.