DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-A and CG6996

DIOPT Version :9

Sequence 1:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:226 Identity:57/226 - (25%)
Similarity:83/226 - (36%) Gaps:69/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFN 75
            ||..:..|:......|:         .|:.:..|.||...:..|..||.:|   |:..||....:
  Fly    26 TLICSLVVNGTKMNDPR---------ACNAWIQCIDGSPVSGSCATGLFYD---RESQKCLSSSS 78

  Fly    76 VDCEDRTELQEPKSSKYCPR-KNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCV- 138
            :.|         .||..|.. ..||.|  ||..||.:|.|.:|......|..|::|:..:..|: 
  Fly    79 IKC---------LSSDPCAALPTGFAA--DPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIR 132

  Fly   139 -WPDTAKREG---CN--PEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVC----- 192
             :|.:.|.:.   ||  |:.       |..||   ||               :|..:.:|     
  Fly   133 DFPCSNKMDPDSYCNILPDG-------VFVKD---TD---------------NCNGYQLCWDGQV 172

  Fly   193 LNGEDPRDLGCQLGEVYNDA-TEMCDAPENV 222
            :||..|       |..|..| |..||.|:||
  Fly   173 INGTCP-------GTFYFKASTAQCDYPQNV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 11/49 (22%)
CBM_14 95..143 CDD:366726 15/50 (30%)
CBM_14 180..225 CDD:366726 14/49 (29%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 11/55 (20%)
ChtBD2 85..130 CDD:214696 14/46 (30%)
CBM_14 146..196 CDD:279884 20/81 (25%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.